PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.B00956.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family NF-YB
Protein Properties Length: 200aa    MW: 21820.6 Da    PI: 4.692
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.B00956.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB138.91.4e-4354146294
             NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 
                       re+d ++P++n++r++++vlP +akis+dake++qecvsefis vtsea++k++re rkti ++dl+ a+++lGf+dyve l+vyl kyr  +
  Migut.B00956.1.p  54 RETDLYMPMTNIVRVLRRVLPPHAKISDDAKEIIQECVSEFISIVTSEANEKAHREYRKTIHPEDLIAAMSSLGFDDYVEHLTVYLDKYRAED 146
                       799***************************************************************************************866 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.4E-4051149IPR009072Histone-fold
SuperFamilySSF471132.33E-3257149IPR009072Histone-fold
PfamPF008081.7E-2060123IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.8E-1587105No hitNo description
PRINTSPR006151.8E-15106124No hitNo description
PRINTSPR006151.8E-15125143No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MEIGGNSNTQ HKDTTRASTS ASVKSTINPE SVAPNLPTSN VGDRNQAPPQ DFRRETDLYM  60
PMTNIVRVLR RVLPPHAKIS DDAKEIIQEC VSEFISIVTS EANEKAHREY RKTIHPEDLI  120
AAMSSLGFDD YVEHLTVYLD KYRAEDPERG ASMQIQLPMV VRSGAQQPSA APVAPPVPPP  180
PPAPLVVMGD GPVIVDDEE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A4e-3554143392NF-YB
4awl_B4e-3554143493NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A4e-3554143493NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012858186.11e-109PREDICTED: nuclear transcription factor Y subunit B-9-like
TrEMBLA0A022RVS11e-106A0A022RVS1_ERYGU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA6044436
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21970.16e-44NF-YB family protein